DPCstruct | MC3820
Metacluster Properties and Pfam Annotations
| Number of structural domains | 174 |
|---|---|
| Mean domain length (aa) | 78 ± 11 aa |
| Standard deviation of domain lengths | 11.03 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 69.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 49.42 |
| Pfam Score | 99.27 |
| Assigned Pfam label(s) | CL0144- CL0370- PF01352 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K6EKX6 | 1-67 | MELLTFRDVAIEFSPEEWECLDTAQQNLYRDVMSENYRNLVSVELAVYKLDLLTFLKQMKEAWNVKR |
| A0A4X1UE69 | 12-85 | GLLTFQDVAIDFSQEEWECLDLGHRKLYRDVMLETYGNLVSLGLVDSKPDVVIFLEQMKDPWSVTRVEARAMHP |
| A0A5F4WKP2 | 1-71 | None |
| A0A7J7F8P6 | 139-204 | None |
| A0A2I2ZWG6 | 5-71 | None |
| A0A2K6BVW9 | 1-67 | None |
| A0A7N4NY69 | 63-133 | None |
| A0A3Q2UN53 | 72-153 | None |
| A0A2J8IK39 | 33-123 | None |
| A0A7J7F7J9 | 5-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.