DPCstruct | MC382
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 220 ± 44 aa |
| Standard deviation of domain lengths | 43.85 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 12.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A3IK22 | 16-238 | LSQMIDLGLKYPSSQFQDKKTGRTYLLTDNFAELWVHIDAKCAVPSFASSTIIKAKVTKWIENENSCPYCAMLCVDVLDKETDYKLY… |
| A0A537DVD5 | 1-176 | MQVQLVKHVAHPKDTVLDGAFYAWANPHGGTTTDGYYPFCFSSPDHRLHDNLKLPAEASVQLAAFPDRFYAYDDEKQMRSSGHWTKD… |
| A0A521BMB2 | 13-273 | None |
| A0A7W1CFM0 | 8-163 | None |
| A0A512PD10 | 15-137 | None |
| A0A2Z2IX01 | 4-193 | None |
| A0A3S0ZRK1 | 23-260 | None |
| A0A7Y4UCM8 | 14-231 | None |
| A0A6N2QXQ2 | 75-349 | None |
| A0A1M6SED6 | 459-720 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.