DPCstruct | MC38199
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 213 ± 34 aa |
| Standard deviation of domain lengths | 34.18 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W0A3M2 | 2-192 | ALVIFASIFANVSSAVDLKKLYQPTLYATKSCQKSVNSILTFMGNLSSSSLYPARAATLYNFDQKDSSMPATMSILPVLNPADTAFD… |
| A0A067BWR2 | 657-862 | FGEWVYVMKDQILFALLASGVALAPTLRIPSTCKVEAVSPSDCRAMLTSISAFLHTYFAPAYLQALRAQAQRVQVDVNALSVDLVTY… |
| A0A1W0A2F2 | 5-181 | None |
| A0A6G0WNR2 | 499-711 | None |
| A0A6G0WPY0 | 475-683 | None |
| A0A1V9Y807 | 44-230 | None |
| A0A1V9Y8R9 | 138-337 | None |
| A0A1V9YS04 | 209-405 | None |
| A0A1V9YSC7 | 314-483 | None |
| A0A1V9ZDJ2 | 7-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.