DPCstruct | MC38198
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 530 ± 82 aa |
| Standard deviation of domain lengths | 82.08 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 29.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14738 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W0A1M5 | 532-1063 | SPVSNTHQVVMEQQIDDNLEPTRSVGVQTMYRDSEAQTLPYTPDYTIKVGTSPEIATLANLTFDNGLPAGMAEIELIERNRKKVAFE… |
| H2YHN4 | 2-480 | IERARAKRAWERTLPPLSDVTQLDKRKKMMDEMETREWSIREIEIEKLQEARLEVLKTLLIQREAKQQELNDKRLDKLWSKKQKAKE… |
| A0A2V2W3Q5 | 2-405 | None |
| A0A1I8IQ60 | 356-973 | None |
| A0A1J1HAQ5 | 122-614 | None |
| A0A7S3ZS08 | 25-525 | None |
| A0A226ERH5 | 77-737 | None |
| A0A7M7NC68 | 108-736 | None |
| E9AHP1 | 47-688 | None |
| A0A6J2JMM0 | 13-517 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.