DPCstruct | MC38197
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 324 ± 33 aa |
| Standard deviation of domain lengths | 32.53 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 31.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4GVD9 | 64-404 | DCPELDDAFVRKSNPLSFTVNDMGTFYDQASIKHKLVQSGLAMPVSTTLVSVQHMYPCVGKFLANDPRCDAATCQLCPPELPMATCC… |
| A0A1W0A058 | 46-335 | RCPGLKSHKSNNPFQFLIKYEKATIKDQLWAKKSAMALGIAFVNIPYFYPCIGQLAHQPECQIGQCTLCPPEIPITTCCVRGKELMP… |
| R1DNB5 | 36-328 | None |
| A2FDP0 | 188-502 | None |
| K2H9K1 | 134-516 | None |
| A0A6A4FGH2 | 129-428 | None |
| A0A397FVK6 | 417-775 | None |
| A0A1V9ZU48 | 456-802 | None |
| A0A3R7ZKM8 | 93-381 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.