DPCstruct | MC38195
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 262 ± 43 aa |
| Standard deviation of domain lengths | 43.42 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 34.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V9ZAG3 | 375-648 | MNASLVYAREVNVYNDLSPNGLMALQLYSMGVRFLWVNCLVLKAFKIAFHYLSSAQATGDNRLVRFCNLSSVFFVYISGIALLNVNQ… |
| T0RCL9 | 1-224 | MKTVLPEYYPHVSHALRFDMFCYNSDIFVLLFASSVVLDIPSAIKFTREVQVYLAECSNSAMSIQLFALSTRLLWINCGFLKLLKYV… |
| A0A3R7WFB4 | 148-460 | None |
| A0A1W0ACL8 | 619-865 | None |
| A0A3R6ZJ51 | 2-267 | None |
| A0A3R6Y8V7 | 606-939 | None |
| A0A067BI45 | 90-294 | None |
| A0A397FD36 | 795-1091 | None |
| A0A485KFV4 | 3-334 | None |
| A0A1V9YS27 | 189-463 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.