DPCstruct | MC38191
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 155 ± 17 aa |
| Standard deviation of domain lengths | 16.56 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 24.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V9YHR5 | 1-151 | MRSGLIAVENALGPFNAVDMKYVLCPQELLVLYSVFTSRLSALLVENPDAQVDFFALPPWPYIAPVPSLLMDNSDYVNLVGGNIMCG… |
| A0A485LL09 | 48-234 | LHAPLGRVFTVVTSTFGQFGSIDMTFLPCPKVAKEAIYRIQVALRRTLFENLAAQSAYDAIPLVPSSAAIPAPKAWTDLNFIPVGGS… |
| A0A1V9ZX63 | 146-287 | None |
| A0A1V9YRM8 | 441-615 | None |
| A0A1V9YHJ7 | 7-143 | None |
| A0A6G0WNN1 | 1-153 | None |
| T0RAY7 | 376-531 | None |
| A0A1V9Y8R9 | 19-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.