DPCstruct | MC38184
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 132 ± 8 aa |
| Standard deviation of domain lengths | 7.92 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.26 |
| Pfam Score | 65.00 |
| Assigned Pfam label(s) | CL0497- CL0172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5QHA2 | 1-150 | MALTDKPILFHFLQSIYSHRILWYELEERYPSRGLTPTTSADIGLQKLFESYPVDGGVFANAVRLMPYWTETGLLKNKAFLNDRQNL… |
| A0A4Q4N281 | 27-158 | CDSRLIISTLESLYPNNALSPSTPADIGIRKLFESWTIDGGIFANTVKMMPYWQEGSFLSSEAFVDDRQKLMGRRFTAQGMQAGRPE… |
| A0A0F9XTC5 | 528-658 | None |
| A0A4Q4TIL5 | 27-168 | None |
| A0A0E9NBW8 | 76-208 | None |
| A0A1V8SDH1 | 66-193 | None |
| A0A370TQ04 | 62-191 | None |
| A0A6C1M0K8 | 19-149 | None |
| A0A6G1H6T3 | 69-206 | None |
| K2QYK0 | 3-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.