DPCstruct | MC38182
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 77 ± 10 aa |
| Standard deviation of domain lengths | 10.46 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 39.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0339 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N2BLB1 | 6-81 | VAPSQVDNLVNMLDGYVAEGGHHLNVNVFTKDTLLDAQAHPEKYPQLTIRVSGYAVKFNSLTKKQQDDVISRTFHE |
| A0A7X9ER73 | 56-134 | DDDVRKANLAGLMDGYFHHEASIEGGQHLNVNVMNREMLLDAMEHPENYPQLTIRVSGYAVRFNSLTKEQQQDVITRTF |
| A0A843GHU4 | 1-77 | None |
| A0A0H3L601 | 110-170 | None |
| A0A7V3DY23 | 697-783 | None |
| A0A661JW40 | 93-179 | None |
| A0A645HTF2 | 6-67 | None |
| A0A5K8A291 | 719-800 | None |
| A0A376ST29 | 149-228 | None |
| A0A377XLW8 | 68-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.