DPCstruct | MC38181
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 50 ± 5 aa |
| Standard deviation of domain lengths | 4.67 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 51.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05901 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A839YAY9 | 208-258 | VAPANPGDDVDCNDFATQRAAQEWFNRYYPYYGDVARLDGNNDGRACESLP |
| E1IG29 | 1-49 | MRPSLPDRDCGDFATQQEAQAFFLAAGGPARDPHRLDGDNDGIACEKLP |
| A0A838SWK3 | 19-63 | None |
| A0A4R7W340 | 270-320 | None |
| A0A4Y8IEV1 | 274-330 | None |
| A0A5N9G9M6 | 39-97 | None |
| W4VGD9 | 19-68 | None |
| A0A323VF20 | 87-137 | None |
| A0A1F6NAE4 | 61-104 | None |
| A0A6N9GLY3 | 119-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.