DPCstruct | MC38180
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 104 ± 12 aa |
| Standard deviation of domain lengths | 12.28 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 44.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0491 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3PK43 | 5-100 | GPLGGLTGGTSKREVLRLYREIIRTANAFYWPNEKGEPWSAVLKRSARKEFEEARNETDPLIVARLVVVGQQCVNETRNKFNAMEEQ… |
| A0A7S1PK70 | 1-108 | MSTPLKFTKKAPPSHITYLNRKFRIQQSIFLYRRILRLTSQMTHYDENGVAWRDILRFSARKEFEASKEERDEEVLARALFTAQMAI… |
| D8QXE3 | 25-129 | None |
| A0A6V7NNH5 | 127-238 | None |
| B9RY99 | 45-168 | None |
| C1N1A4 | 39-153 | None |
| A0A1V9YAQ5 | 1-86 | None |
| A0A6D2HDC2 | 68-148 | None |
| D3BF09 | 1-76 | None |
| A0A2J6KH40 | 68-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.