DPCstruct | MC3818
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 93 ± 15 aa |
| Standard deviation of domain lengths | 15.13 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 65.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 43.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00428 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4X1U877 | 3-88 | SVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFWPGLFAKALANVNIGSLICNVGAGDLPQQLVLHQQEVLPQPTLLPQ |
| A0A498KJ55 | 371-432 | MSTAELACSYAAMILQDDGIAVTAEKIAALVKSANVSVESYWPGLFAKLAEKKNLEDLFLNA |
| A0A7S0E2D2 | 27-110 | None |
| G3JUX2 | 181-276 | None |
| A0A0N5CX80 | 30-110 | None |
| A0A438DQI5 | 102-178 | None |
| Q4U8Y0 | 7-116 | None |
| A0A5J4YQQ1 | 6-98 | None |
| Q16UQ3 | 15-112 | None |
| A0A7S3FRU5 | 26-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.