DPCstruct | MC38178
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 147 ± 7 aa |
| Standard deviation of domain lengths | 7.03 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 23.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N6T638 | 1-149 | MSAPVKTPSFATENPSDPVARAHWALRKAEYELFKEYAEGDRELVDSRDFDQEYARLSKSTGMPKWQVDHAVMAYMALRELPRLREL… |
| A0A6I8MDM5 | 1-139 | MAFYRCCDMGDEFACEEILLNQFEYQRWLRVQPHPDDDVTAYCSALGARIDKTEHFVLRRIDAISTLLELKGLHALFLQLWHLDMPR… |
| A0A1I2V8J6 | 1-152 | None |
| C0WFT5 | 1-138 | None |
| A0A1I2QN52 | 122-266 | None |
| U7KGI1 | 37-195 | None |
| A0A809QHK8 | 1-141 | None |
| Q6NIZ4 | 53-195 | None |
| A0A0K2H329 | 1-158 | None |
| A0A1Q2HYY5 | 1-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.