DPCstruct | MC38177
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 100 ± 13 aa |
| Standard deviation of domain lengths | 13.09 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 55.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0617 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W3UGQ7 | 11-95 | KNTDWWPNQLKLNILRQHSSLSNPMGEDFNYAEEFKSLDLKAIKKDLHNLMTDSQEWWPADFGHYGPFFIRMAWHSAGTYRTGDG |
| A0A3T1DZS2 | 3-102 | GKCPVMHGGNTSTGTSNKDWWPEGINLDILHQQDRKSNPMDADFDYREEVRKLDFDALKQDVHALMTDSQSWWPADWGHYGGLMIRM… |
| A0A4V3HWL9 | 1-104 | None |
| M0BW50 | 15-98 | None |
| A0A0B0EBN4 | 81-175 | None |
| A0A7C7ZAD1 | 2-101 | None |
| A0A811B177 | 1-109 | None |
| M4RV56 | 1-114 | None |
| A0A0B0HHE2 | 5-129 | None |
| A0A432VFP9 | 394-476 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.