DPCstruct | MC38173
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 103 ± 11 aa |
| Standard deviation of domain lengths | 10.78 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19474 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F2WG69 | 94-194 | QLPVSRYALPRKNDPDVWDFFELVERKNGRRFMNRLLGSPGDWRRDYLCAELQIAAARAIALDPRASAVAYAKRHRRCAVCDAPLSH… |
| A0A7W5VI76 | 1-107 | MPTTTVEPGVYTKDGQVYEVKQSRRFAGSLTIKRLEVSRGKLRRRPSPIRVEDLSSSDAISEEQAAAFGHEHGICACCGRALSDPES… |
| A0A1E5NXQ2 | 15-111 | None |
| A0A521YP40 | 57-162 | None |
| A0A418L5G9 | 128-226 | None |
| A0A2Z4J6F8 | 90-179 | None |
| A0A4S2UJF9 | 372-474 | None |
| A0A3A4A484 | 85-176 | None |
| A0A653F656 | 157-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.