DPCstruct | MC38172
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 192 ± 19 aa |
| Standard deviation of domain lengths | 18.94 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z5R3V8 | 74-268 | ELPAMRAVIQWYAWLTQNNPDIFAAHMMPAVKGAKFAKVIHGMEPALEAFEHAHQVLGEPSYSFLAYAASAAERQYRSATAQALAAL… |
| A0A7W5VEG3 | 31-229 | LERTTGYPGYAHDLEWWPSIMPSHREVLAAHLLEYLPTSGDTEVLAALVHGEGPLGAATAGVIAVGMGHERRRQRAAAGDALITLAA… |
| A0A1Q9U8V2 | 764-942 | None |
| A0A7Y0ANN2 | 144-358 | None |
| A0A7C7V4W1 | 255-445 | None |
| A0A3P1WWR4 | 310-499 | None |
| A0A4V5V0H4 | 457-633 | None |
| A0A2Z5QZZ6 | 5-150 | None |
| A0A2Z5QZX9 | 252-445 | None |
| A0A2P9IAH8 | 189-384 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.