DPCstruct | MC3817
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 78 ± 10 aa |
| Standard deviation of domain lengths | 10.23 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S7K9S5 | 99-164 | DLSNANIVAILLSQSQSRYSGSCPCPFYSDRAGRRCGARSAYSRPGGASPLCYKSDVTDAMIRSFR |
| A0A1Q3T377 | 6-86 | SFTAMTYAGVGKDLTDGEVRDRIIGGSISAYDGGPCPCPYTEFKNDQICGDSSAYSRGEDIKCYRKDISDREVKRYRIENG |
| A0A380W7T3 | 85-171 | None |
| A0A2E3H684 | 69-155 | None |
| C9XYP8 | 2-58 | None |
| A0A841HP48 | 14-96 | None |
| A0A1Z8LN28 | 11-79 | None |
| A0A2M8UCK4 | 15-95 | None |
| A0A437MNR3 | 9-89 | None |
| A0A3B0TQU8 | 31-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.