DPCstruct | MC38169
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 63 ± 5 aa |
| Standard deviation of domain lengths | 4.51 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 55.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W5V5C5 | 1-71 | MDWLGMATFDPEGLSFAQRDGDACVVCHKRWPRPRVHVGRLPDSSRVLACPDCAEALLPAMSATVVGLPSR |
| A0A399G4S0 | 8-64 | ADEDDGHVFTPEGLSDAQAMGEACVVCHARWPRPRHPLGVLPDGAPVYGCAECAQLA |
| A0A4R5AHH5 | 28-85 | None |
| A0A7K1KVE3 | 1-57 | None |
| A0A7K0BP37 | 1-61 | None |
| A0A4R4MH84 | 1-67 | None |
| A0A372JC98 | 56-120 | None |
| A0A161LH94 | 9-66 | None |
| A0A5S4H626 | 1-67 | None |
| A0A5C4J6H1 | 77-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.