DPCstruct | MC38161
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 66 ± 4 aa |
| Standard deviation of domain lengths | 4.36 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 59.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8YT65 | 73-132 | LGRFTEPNEIFGPVDLRKLREGTVETDVSGMLPEAEIAFLDEIFQGSSAILNTLLGILNE |
| A0A6S6S253 | 1-65 | MTRFSTPEEIFGPLSIQALKEEGRYQCLTTGYLPDAEIIFLDEIWKAGAAILNTLLTAINEKNLE |
| A0A813BJJ8 | 842-901 | None |
| A0A1X9SQM3 | 77-145 | None |
| A0A812L0T4 | 317-381 | None |
| A0A3M6Q371 | 71-134 | None |
| A0A286EIZ0 | 74-137 | None |
| A0A378FSI6 | 1-65 | None |
| A0A1M7MMK7 | 155-231 | None |
| J9H3M1 | 20-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.