DPCstruct | MC38160
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 124 ± 14 aa |
| Standard deviation of domain lengths | 13.78 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E2DJ72 | 1-141 | MSHLHIDDFSHDVARILMQAYMTFPRPGALYVEDVIGPTEVDDVGLHSARHMACLGAMLWLAEEGYLRYQATIFEEGLEQAVLTNKA… |
| A0A6S6RXP6 | 1-105 | MSNINEFYEYPERLFGLLYNIFPQPQSLYVYDIADLIDTKEAAKIIKTKSKKVVYAVKWLYQYGYISLDITHTGAFNDIFLTKKILY… |
| A0A4R5HGV9 | 3-141 | None |
| A0A4R3NAH7 | 1-118 | None |
| A0A3N8CY62 | 5-101 | None |
| A0A6M5Z796 | 6-129 | None |
| A0A851HSN4 | 182-318 | None |
| A0A3S3SB82 | 172-303 | None |
| A0A1H9F1B9 | 2-102 | None |
| A0A3M2E346 | 4-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.