DPCstruct | MC3816
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 185 ± 19 aa |
| Standard deviation of domain lengths | 19.46 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 17.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q3SVA7 | 1-182 | MGFFDGFVSIVFKKDAAERMVFYPWSIFGAGYIVPSEEKYRSICTLFKKMAKIFIPLFIVTFIALEWVELPKFQWVFELSLTVLFLI… |
| A0A537S9Q7 | 33-251 | RAEQRRLALRSKHVSSFIIRRLTMLVPKGVEEALFKRVVDGWIFSAPNPWTFGRRHSYLVNDAQKAELGMRVRRGRYFRIVALIPMF… |
| A0A6N1DP84 | 141-336 | None |
| A0A844CYB4 | 1-169 | None |
| A0A172YBM5 | 11-167 | None |
| A0A1M6PZ62 | 2-201 | None |
| A0A7C2SAA6 | 3-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.