DPCstruct | MC38159
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 60 ± 6 aa |
| Standard deviation of domain lengths | 6.21 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 59.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A4N1Z2 | 110-170 | AVAHKMNRQYIGIEQMDYIETLAVERMKKVIDGEQGGISKAVNWQGGGEFVYAELAPFNET |
| M7SR38 | 88-148 | AVAHKMKRRYIGIEQMDYIETITKERLKKVIEGEQGGISKKCGFKGGGSFVYAELKEVNSG |
| A0A5E6NCH2 | 13-87 | None |
| A0A1M5LAN4 | 200-254 | None |
| A0A6N4RHH5 | 381-442 | None |
| E1L032 | 2-58 | None |
| A0A809N8P1 | 162-223 | None |
| A0A645A5W9 | 1-50 | None |
| A0A644X9I9 | 27-87 | None |
| G0EKX2 | 1-56 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.