DPCstruct | MC38158
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 101 ± 11 aa |
| Standard deviation of domain lengths | 11.36 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 41.05 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0123- CL0671- CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z8D986 | 80-179 | RFGIVQRLEFYNVDDLQHIVARSASFMGLEITAEGARQIAMRSRGTPRITNRLLRRVRDFAQVKGNGEIDEDIASKALDMLNVDAAG… |
| A0A6S6RWX5 | 62-151 | YGVIKIKSLSYNVDDLQTIVLRSAHFMGLKIFNAGARQIAMRSRGTPRITNRLLRRVRDFAQVKGDGIIDGDIASQALDIMLNVDSA… |
| A0A2D5AUS1 | 323-423 | None |
| L7W115 | 487-586 | None |
| A0A1E7I569 | 601-709 | None |
| R7K7E0 | 312-417 | None |
| A0A6G3UYD4 | 1-103 | None |
| A0A813ASQ0 | 169-269 | None |
| A0A6L5C9U8 | 677-782 | None |
| A0A0G0NFD9 | 169-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.