DPCstruct | MC38154
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 176 ± 28 aa |
| Standard deviation of domain lengths | 28.34 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 91.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13030 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M7N5Q9 | 1-143 | MHISYLYESLRGSQKQIDQLLDEQKRQQQQWRRSLKLSKEKAEAAYRLLHWCDRCSLILCRRQLPEDERRLEVFQGPDRTVYHLWQR… |
| A0A7Y5TYM7 | 34-222 | REHDNGWRELDEEIVFDGAAGRALDFIDAPDRVKQRVWPRGVDRLAAASAYAAALVAQHAIAVYDSHRDEPAWAAFFAAMRQRRDEL… |
| A0A1E8B869 | 1-180 | None |
| A0A2P6WI31 | 93-318 | None |
| A0A537YEZ3 | 10-199 | None |
| A0A2V8J1L6 | 178-351 | None |
| A0A7Y5G749 | 2-156 | None |
| A0A2V9GG87 | 2-204 | None |
| A0A1P8WCP5 | 3-171 | None |
| A0A7Z9Y110 | 53-255 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.