DPCstruct | MC38152
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 197 ± 27 aa |
| Standard deviation of domain lengths | 26.95 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 71.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 31.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9DCA5 | 68-262 | MYMSGTSMSTPIAAGAAALLLEANPNLTPSMIRMILQYTAQPIDGADMLEQGAGMLNIEGALRLARSLRTDLKFDGASRGTSMVPAG… |
| A0A7Y4WXI5 | 1-217 | MAAPVVAGAAALMIQVNSKLTPNLVKAILTYSAQPMTGYNTLEQGAGSLNVDGAIRITKLIKTTIPTTNGTAMLSASLPTSQTSTIA… |
| A0A2D6R0J9 | 24-248 | None |
| A0A2V8BKS8 | 34-215 | None |
| A0A2V8QQD5 | 27-230 | None |
| A0A2V8QPU2 | 237-406 | None |
| A0A3N5P614 | 541-717 | None |
| A0A7W1G9I4 | 64-315 | None |
| A0A7W0UZE0 | 115-328 | None |
| A0A7X7UF69 | 460-673 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.