DPCstruct | MC3815
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 234 ± 49 aa |
| Standard deviation of domain lengths | 48.74 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 79.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14882 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q3SS07 | 2-242 | TNLKKPFLNFREAKSFAHSLQLKSREDWLLYCKSGRRPMKIPASPHLAYKEKGWVSWGEWLGTGIIAPQNRKFRSYKQARQFARSLR… |
| A0A3M7LLL3 | 2-150 | FYATWQEASASACKIIPDEKKTKLGYQEYYKQNPLLHSNLDKYYTDFPGWDAFYGREVLKKYSLEEARKFCSDNNLWSRDDYKKLAL… |
| A0A5E4RHY2 | 230-494 | None |
| A0A5E4RDZ5 | 1-348 | None |
| S5AJ27 | 26-216 | None |
| A0A7S3CBK9 | 77-262 | None |
| A0A7S2X2E8 | 196-382 | None |
| A0A3A6TWL1 | 260-500 | None |
| A0A0G1VY41 | 80-315 | None |
| A0A062BRD6 | 4-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.