DPCstruct | MC38144
Metacluster Properties and Pfam Annotations
| Number of structural domains | 100 |
|---|---|
| Mean domain length (aa) | 142 ± 21 aa |
| Standard deviation of domain lengths | 20.77 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 92.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 18.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A5J9S3 | 1-133 | SSTNTLVITSEEKSVRNFPSFTNKMSYWFFFKNEWFNLIATVENDGIKFYINVASPFIYEEQAVKYYDFDLDFKISSDDKWKEVDVN… |
| A0A2R4SZ91 | 7-151 | EVRLVKAGATKIRYPAEVVADDGTRLTVRAPWAGDGVRDFGFVRFEAGDVFTEYYWRDRWYAVKEVRSGDGTLKGWYCDITRPAVLD… |
| A0A3E0HQX7 | 68-210 | None |
| W7KU92 | 258-398 | None |
| A0A536HLT0 | 1-124 | None |
| A0A8A5D508 | 20-190 | None |
| A0A117SMV0 | 94-245 | None |
| A0A7X3ZSG7 | 27-169 | None |
| A0A7C0XX30 | 221-370 | None |
| A0A3B0P631 | 1-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.