DPCstruct | MC38143
Metacluster Properties and Pfam Annotations
| Number of structural domains | 132 |
|---|---|
| Mean domain length (aa) | 170 ± 37 aa |
| Standard deviation of domain lengths | 36.95 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 75.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10256 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D3BQF0 | 11-195 | IDVNSNHVQKCVELQPNDRGYFYDNYPVELMGLIDPQEFSGIITRFNSLAASWRNRLPLIGVACAMLATIVLLGVFGSKRSLIGIVV… |
| A0A183XQF0 | 4-144 | RADEVRVLLNTCNKVFVQRDYSKGLGVQFETTFPVALEGKISEQAWAYTITTLNSYYTKAEEVCCGTILETLTGCLSCYISRLFVKT… |
| F4Q012 | 372-568 | None |
| F4Q3H6 | 10-235 | None |
| A0A7S2U8B8 | 26-237 | None |
| A0A2G8L6I4 | 57-172 | None |
| A0A7J6CLS0 | 5-125 | None |
| A0A0D8XKJ1 | 10-143 | None |
| A0A284QN03 | 5-224 | None |
| A0A671TEM3 | 87-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.