DPCstruct | MC3814
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1349 |
|---|---|
| Mean domain length (aa) | 122 ± 18 aa |
| Standard deviation of domain lengths | 17.89 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.00 |
| Pfam Score | 94.71 |
| Assigned Pfam label(s) | CL0689- PF18393- CL0508- PF00691- PF07715 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E4X6X9 | 11-119 | EVGDRVFFDYDESRFKNEGVETLKRQARFLLNNKDLTVRIEGHCDQRGTREYNLALGERRAFSVKSFLVSLGVEESRISVISYGKEK… |
| A0A1Q3SEX5 | 31-152 | APTPAKYSVENKEMNAIYHFAFDRSELSEQDMPALNEFATFLHANPSMKAHVDGYTDAQGPYNYNLNLGLRRAEAVAEYLQAKGVPA… |
| A0A4R4D5T5 | 30-141 | None |
| A0A7C0Y6G3 | 16-132 | None |
| A0A537IST2 | 17-133 | None |
| A0A4R2JQG8 | 49-175 | None |
| A0A3G2G5L6 | 307-421 | None |
| A0A7Y3J2Q7 | 385-514 | None |
| A0A1B0C1Q4 | 472-602 | None |
| A0A7C0U1U3 | 248-370 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.