DPCstruct | MC38132
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 244 ± 54 aa |
| Standard deviation of domain lengths | 53.76 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 75.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 14.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10087 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R2DE32 | 16-274 | EVNESQIHDLNLKSGDIVEAIPLSDGLNEAEVLRVVGYRKLRSRDYDKIEDFKYGVVQGTPGNLSVSRNIHGERLTINHKPVIVALD… |
| A0A0M3RFC4 | 25-205 | QDMERLGYLAFEDGEWIFTDLTTTAEINCFPVKDPSIIPPDSTDLPARARVQVGVAEITRFYSWYGSTPTSNNKKENRKDSKPKKYK… |
| A0A828YGZ3 | 45-311 | None |
| A0A0R1XNG4 | 108-305 | None |
| A0A1C0Y8R2 | 569-808 | None |
| A0A558MB90 | 360-546 | None |
| F0K2B1 | 90-364 | None |
| A0A139R278 | 129-313 | None |
| A0A4Q0I4Y5 | 366-575 | None |
| A0A4P6YSK0 | 483-664 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.