DPCstruct | MC38131
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 290 ± 17 aa |
| Standard deviation of domain lengths | 16.62 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 76.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 23.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R2D766 | 1-254 | MKYSFVADMSYDWSGNLGFKMPKNWAFDQFVEYPIGGTPIDQVAASGKDSGTKYFSPGTENTISVSDALDNIRKNLGNKFAVDLNKT… |
| A0A5F0MF21 | 109-401 | YKSGIYGTRNVCQRAVDAGAVTNCFVSDMSTGFSGNLGFKMPKEWAFDQFIEMTVGRGDMLFAIDQVASSGRDAGVTKFDVDSSQKV… |
| A0A0R1V0K8 | 1-291 | None |
| W1YPF7 | 425-732 | None |
| A0A1Q9YK13 | 14-324 | None |
| A0A416GBV8 | 157-437 | None |
| A0A200ID37 | 8-294 | None |
| A0A3F3HXK2 | 65-361 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.