DPCstruct | MC38130
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 67 ± 4 aa |
| Standard deviation of domain lengths | 4.24 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 41.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S5Z4Y1 | 4-67 | PDLFDFHEHQPEFLSGIVTHYEKLLDLGERDGYQVCAEFLKVVKSVGYTFSYGLDGVPYDLRLL |
| A0A3D9AH73 | 171-233 | DLLEHYELMPKELENICRPWLDKHDDVGLSYEDCETFLNQVEGIGYTFEYYLDAEPYCLRPQS |
| A0A088EY13 | 56-118 | None |
| A0A1Q8G331 | 12-74 | None |
| A0A077ED86 | 1-64 | None |
| A0A4R8I020 | 1-69 | None |
| A0A086FAT5 | 1-77 | None |
| A0A1W6KFN5 | 1-69 | None |
| A0A2T1NNL3 | 2-65 | None |
| A1U835 | 100-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.