DPCstruct | MC38127
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 168 ± 19 aa |
| Standard deviation of domain lengths | 19.38 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.70 |
| Pfam Score | 92.44 |
| Assigned Pfam label(s) | CL0361- CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482WRR4 | 12-182 | ADSNEALELKLIRRPGDVDNDSESVTFKPAMSHQVFSQSENIFGYKDLKVKLYYTAAWLTTYVGIEFSEQIDPDDFDGIEADNIMEK… |
| A0A556U4R6 | 290-457 | CDTNEAISLNLVRFPEDIEDESTTFHPEFSHQLFGDDEVAFGYKGLQIQLSYTAGNLSTLFKVKYTSKVNEKFDCVQPDDVEGKIRE… |
| A0A4Y7LZS8 | 14-183 | None |
| K8F2S2 | 103-284 | None |
| R9NZF9 | 5-180 | None |
| A0A817C291 | 266-402 | None |
| A0A820FXQ9 | 11-152 | None |
| T5AIU3 | 23-176 | None |
| A0A0R3QB64 | 8-146 | None |
| A0A4Z2GK97 | 66-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.