DPCstruct | MC38124
Metacluster Properties and Pfam Annotations
| Number of structural domains | 243 |
|---|---|
| Mean domain length (aa) | 439 ± 78 aa |
| Standard deviation of domain lengths | 78.37 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 16.28 |
| Pfam Score | 79.38 |
| Assigned Pfam label(s) | CL0063- CL0022- CL0123- CL0127- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C8KKW8 | 34-488 | AGCGVQPLSASPGSTHDDADAARRIEADLRFLADDLLEGRQAGTRGYDLAARYVEARFRAMGLEPGGDAGSYLRAVPMVQGLRIPDG… |
| A0A825NR48 | 1-306 | HSIKSGTKVFDWIVPDEWNVKEAYIITPEGEKICDFKKHNLHLLNYSEAIDQEIELEELQDHLYSIEEMPDAIPYVTSYYKRRWGFC… |
| R7UMH0 | 31-379 | None |
| A0A4P1JYU5 | 3-358 | None |
| A0A523E0V9 | 569-1035 | None |
| A0A3P3W2S5 | 28-467 | None |
| A0A135V988 | 397-913 | None |
| A0A317V723 | 418-862 | None |
| A0A446PYH9 | 38-565 | None |
| R7KMF7 | 2-415 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.