DPCstruct | MC38120
Metacluster Properties and Pfam Annotations
| Number of structural domains | 253 |
|---|---|
| Mean domain length (aa) | 373 ± 90 aa |
| Standard deviation of domain lengths | 89.84 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 80.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.57 |
| Pfam Score | 73.89 |
| Assigned Pfam label(s) | CL0123- PF11799- PF13438- PF00817- PF14377 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H2IDT8 | 27-427 | ADIEKYRNASVEVFKVLNNIDSSIVVEKASVDEAFLDMTSYVDQRLIEFKKSDKDVVDYFSMLPTSYVVNGKDENEKDRESHLESFV… |
| A0A661RBH7 | 95-420 | EQQRRPELAGKPLVIGGKGDPTKRGVVSTASYEARKFGIHSAMPLRTAYKLCPDAVFLPVDYKDYSRVSKMIKKILREFTPIIEEAG… |
| A0A0N1PFW4 | 43-503 | None |
| A0A6I9KIH2 | 86-584 | None |
| A0A2V2QHL2 | 3-357 | None |
| A0A182F7A1 | 22-480 | None |
| A0A3A0BBW6 | 74-421 | None |
| A0A7M3LXL3 | 123-476 | None |
| A0A158FIF7 | 19-406 | None |
| A0A3L7PMJ4 | 14-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.