DPCstruct | MC3812
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 201 ± 24 aa |
| Standard deviation of domain lengths | 24.44 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 29.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C3P7P0 | 9-214 | DAVVMSNEWSASVGTVEVDGRSINHQYSKGEAFENSLRSVLAETLAGRPDYFSLLRPFTELWIARRFAAYPQYFDHFRSCNRAFHLD… |
| A1S0F5 | 255-443 | LALKYGVGNIVMGNEFDDPSGLTFEYKGIRHYYATYDQSLDFDVYMTRYFEERGLGIKQWSPLRPVTPITILRILFDRYPDLAPLVT… |
| G4ZQK1 | 506-717 | None |
| A0A3M1WX50 | 215-409 | None |
| A0A1G2R431 | 81-262 | None |
| A0A661ZWK6 | 97-307 | None |
| A0A662YI43 | 161-375 | None |
| A0A563BDG4 | 264-479 | None |
| A0A7L6B4Q7 | 40-253 | None |
| A0A832QBC3 | 1-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.