DPCstruct | MC38118
Metacluster Properties and Pfam Annotations
| Number of structural domains | 270 |
|---|---|
| Mean domain length (aa) | 281 ± 52 aa |
| Standard deviation of domain lengths | 51.67 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 16.29 |
| Pfam Score | 89.52 |
| Assigned Pfam label(s) | PF18151- PF02204- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H2IBN4 | 18-288 | SLEARKEFSDFLVANLSTAMTQEIARSVKNAVGKIVEMRLNLDDMSELVMSYYQYLSERIGGHAFFNTPDCKVKVEDVMDQVEKYIS… |
| A0A6J1WGV4 | 2-152 | DEKATRLTASIKAITAELKADPSWEGASSALLETLELTVERAAFARLYLHVMFPNGDGDIARDQVLHEHVRRVAGATSAARAGVAAR… |
| A0A7M7N533 | 666-940 | None |
| A0A6P8VY83 | 402-730 | None |
| A0A226F590 | 561-879 | None |
| A0A226F173 | 233-524 | None |
| A0A0R3UN12 | 74-367 | None |
| A0A818ZGY2 | 124-409 | None |
| A0A5N6Q7N4 | 346-679 | None |
| B0E5X3 | 7-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.