DPCstruct | MC38117
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 216 ± 11 aa |
| Standard deviation of domain lengths | 11.21 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05075 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H2IBB0 | 1-235 | MDKEIEPFAQLIDEFLKAETVSFEKLKTRLDSIAVAGRIVNKYTLAIRANRKLSERNSLELKLEEIGNKLEELAEKMALHFNELLLM… |
| A0A6A5GHF4 | 7-218 | LQIINNATLLINDFLNTGRFSFDHLSTRLPVITELGSFIGTLQNEVPKEPRITEAFLNQEDLMCQLTDKMNRNWDVLKWTMSGNSMF… |
| G0P045 | 1-189 | None |
| G0P415 | 30-253 | None |
| G0P412 | 44-266 | None |
| E3MBL9 | 1-219 | None |
| A0A2P4UTE5 | 7-218 | None |
| E3NET1 | 78-290 | None |
| E3N860 | 40-254 | None |
| A0A2P4UYH4 | 73-286 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.