DPCstruct | MC38116
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 158 ± 22 aa |
| Standard deviation of domain lengths | 22.43 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 43.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0328 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H2IAM2 | 20-162 | GISVKDVDEKSRKRIGWWLMGCAGMCYGAVAIGGVTRLTESGLSMVNWDLFKTMKPPIGQKQWEEEFEKYKAYPEYKFKSSSHEMTL… |
| A0A7Y5GYG6 | 20-146 | PVRNWLLGMFFLIFAMTIVGGITRLTESGLSIVDWNLIMGTIPPLSDADWVTEFEKYQTSPQYQQVNHSMTVDQFKRIYVWEYVHRL… |
| A0A5P1EX26 | 77-276 | None |
| A0A0R3QFH1 | 6-131 | None |
| D3BJT5 | 136-257 | None |
| A0A812D6V0 | 8-155 | None |
| A0A833T276 | 54-215 | None |
| S9X679 | 34-202 | None |
| A0A6P5GMA7 | 68-242 | None |
| A0A2H6K908 | 80-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.