DPCstruct | MC38115
Metacluster Properties and Pfam Annotations
| Number of structural domains | 83 |
|---|---|
| Mean domain length (aa) | 216 ± 42 aa |
| Standard deviation of domain lengths | 42.31 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 77.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 23.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04678 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H2I446 | 39-239 | TSIEHLLQFGAFRLRVNDKFYDVTVPEHQGALPYGSDKLRQLDDLRATVASLHVALCVDEYKLSREKKLLLQLENAEALLKPLEVVK… |
| A4HZ34 | 2-119 | ERIKAECDEIAFHYPDVFMKQLFAFLVLQAAVLFDWTYVHFDWNFVEPITYLVGYSATWIAIAWYGAMQQEFSYESLHRFLQNAKRE… |
| E1ZB89 | 20-214 | None |
| A0A401KW66 | 808-1077 | None |
| A0A5J4YR38 | 55-246 | None |
| A0A813SQC0 | 277-504 | None |
| A0A834NJZ7 | 37-287 | None |
| K8EKE3 | 204-385 | None |
| G4T673 | 98-394 | None |
| A0A6V8HJK3 | 184-446 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.