DPCstruct | MC38110
Metacluster Properties and Pfam Annotations
| Number of structural domains | 120 |
|---|---|
| Mean domain length (aa) | 185 ± 32 aa |
| Standard deviation of domain lengths | 32.48 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 19.18 |
| Pfam Score | 98.08 |
| Assigned Pfam label(s) | PF00384- PF02613 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G2FI20 | 8-163 | PDQDAREIIQGLAEQHPWLAEAAEELGSTPLEQWQGEYTRLFISGFPKTACPPYESAYRSGTMQGPTVAKLERLYAQLGMRSSEMPA… |
| A0A7C2H0V4 | 6-146 | ERLAQLYAELGQALLKPPEEQDAAIEYYRLFFNPQGSPCPLWQSVYEKEEGKPPQLFGDSHHRALAWYRRYGFEPAAKNEPADHLGL… |
| A0A2P9ICU7 | 2-191 | None |
| A0A0C2MKV8 | 488-685 | None |
| A0A2V2E341 | 11-228 | None |
| A0A128EEM6 | 3-192 | None |
| A0A8A8V868 | 10-140 | None |
| A0A4U7DJB7 | 13-255 | None |
| A0A3C1BT81 | 13-201 | None |
| A0A140D9E0 | 9-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.