DPCstruct | MC3811
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 96 ± 25 aa |
| Standard deviation of domain lengths | 24.71 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 82.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 43.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W9WDU9 | 71-165 | RPLSRLIADFNTYVEQNRYFIVDYSERHHYGERVSTGFVESAVNQVLAKRMVKRQQMQWTKKGAHLLVQARTKVLNEEWEDCFRQQY… |
| A0A1C3P0V6 | 2-82 | LVKRLAEFRGYIDANTARIPNYGERRRCGEAVSSATAESAVNQVVSKRMVKKQQMRWSPRGAHLLLQVCTRILNGDLTADF |
| A0A7H9UIG1 | 78-154 | None |
| A0A2A3MP61 | 32-127 | None |
| A0A249Q5Z9 | 17-91 | None |
| A0A2C9B8K2 | 33-140 | None |
| A0A238LN08 | 57-130 | None |
| A0A2P8KBI8 | 23-191 | None |
| A0A142H9G0 | 1-89 | None |
| A0A439EXQ8 | 19-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.