DPCstruct | MC38100
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 112 ± 11 aa |
| Standard deviation of domain lengths | 11.33 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 65.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 47.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q32PN8 | 1-123 | MKASVPVRPHKLPSSCSQLSLRYLSESSRCKMEDEDLFCLQYDMNDCYSRLKRLVPTIPQDKKVSKVEILQHVIDYILDLQLALETH… |
| A0A2I4BT28 | 1-95 | MKAISPVRSVRSCYRAVCCVSEQSLAISRSSNPKHSCVDEPVSALCDINDCYSKLKELVPSIPQNQTVSQVEILQHVIDYIFDLEMV… |
| H3AFJ0 | 1-131 | None |
| S9XVC1 | 1-103 | None |
| A0A7J6AKU2 | 45-169 | None |
| V9LFU7 | 1-108 | None |
| A0A444U5S8 | 1-98 | None |
| A0A452FYD9 | 33-151 | None |
| A0A6J2FFF1 | 15-126 | None |
| A0A4U5V335 | 1-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.