DPCstruct | MC381
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 212 ± 25 aa |
| Standard deviation of domain lengths | 24.65 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B1MNK2 | 9-208 | TDEVDGLIAIGLAHDFWRGQWSTVEEAHIHRPPHRIRRISDGEMFAANIKVTRIMLEEFRSGFDLERVVQRLTEPGQLRVGRWEGTE… |
| A0A397MTK1 | 276-468 | DTDALVSAAAVGLVADAWREGPLEVIHAADDGPSDGEIFAQSVDLYRRARAALVAARDDGPEVLLAFVAVASDVDLPWAGGSRFALR… |
| A0A366CSW9 | 116-323 | None |
| A0A2W6BX50 | 354-586 | None |
| A0A7G6WWF1 | 362-567 | None |
| A0A840LUN2 | 63-241 | None |
| A0A1R0KGI9 | 2-209 | None |
| A0A4D4LDL3 | 22-256 | None |
| A0A6B3AZM7 | 168-398 | None |
| A0A6I8LU84 | 5-274 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.