DPCstruct | MC38098
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4078 |
|---|---|
| Mean domain length (aa) | 215 ± 41 aa |
| Standard deviation of domain lengths | 40.92 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 14.41 |
| Pfam Score | 98.06 |
| Assigned Pfam label(s) | CL0205- CL0678- CL0550- CL0113- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I4BQG3 | 24-246 | KIIHGKEVPKNSMQYMVSIQDKYGFHLCGGFLIREEFVVTAAHCDELESPIHQIFLGSHNLRKNGILKTFDYKCKPPTYENLGLGDD… |
| Q7M135 | 18-235 | HRDVIRSVAAYSKQGTMWCTGSLVNNSANDKKMYFLTANHCGMTTAAIASSMVVYWNYQNSTCRAPGSSSSGANGDGSLAQSQTGAV… |
| A0A5B7DEZ9 | 99-316 | None |
| A0A538QC88 | 3-168 | None |
| A0A538Q113 | 372-612 | None |
| A0A5N5TP06 | 125-301 | None |
| A0A5N5TDE6 | 284-453 | None |
| A0A6G1IM22 | 297-562 | None |
| A0A6B1AFY8 | 126-315 | None |
| A0A2G7GCC3 | 41-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.