DPCstruct | MC38093
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 81 ± 13 aa |
| Standard deviation of domain lengths | 12.69 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 80.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9GSG8 | 45-129 | DSNLDLPILSSRAQHDKRSDCWSVCSQVWRLDLVMVILFKAIPLESTDGERLEKSPECAHPGLCVNPYHINVSVRELDLYLANFI |
| A0A0J7KSM1 | 172-243 | MRRIDCLRQADKVWRLDLVMVILFKAIPLESTDGERLEKTAECAQPGLCVNPYHINVSVRELDLYLANFITS |
| A0A401SYJ1 | 243-315 | None |
| W8Q262 | 108-180 | None |
| A0A1U7SUQ6 | 38-103 | None |
| A0A6P9DDP0 | 159-268 | None |
| A0A3L8SNN9 | 140-211 | None |
| A0A5E4BSJ9 | 116-187 | None |
| A0A1D2N8V5 | 56-134 | None |
| A0A3B5LMA1 | 113-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.