DPCstruct | MC38092
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 181 ± 49 aa |
| Standard deviation of domain lengths | 49.40 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 69.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 34.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18264 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7RIN4 | 1-146 | MKPNSEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPVPAEDVDTPPRKKKRKHRLWAAHCRKI… |
| A0A2I4AJ42 | 80-239 | TSSSEGNSRCQTPVKMKLSGEAEAVDWSGAEASLFRVLIGTYYDNYCAIARLIGTKNCRQVYEFRVKESAIIARAPAEDEDTPPRKK… |
| W2P928 | 38-175 | None |
| A0A287VTE2 | 133-380 | None |
| A0A287VTC4 | 21-261 | None |
| A0A287VSS1 | 4-262 | None |
| A0A287VSQ9 | 315-562 | None |
| W2Z7F1 | 52-174 | None |
| R7T4Q6 | 126-365 | None |
| W2X041 | 38-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.