DPCstruct | MC38091
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 65 ± 7 aa |
| Standard deviation of domain lengths | 7.47 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 78.24 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | PF17659- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I4AHW2 | 2-71 | PTSVAYLQSNQVMGWGEKAIELRSANTGNLEGVFMHKKTQKLKFLCERNDKVFFASVQSGGSSQIYFMTL |
| A0A819NE62 | 6-67 | PTSVAYISNGKVMGWGNKAIEIRNVDSATLDGVFMHKRAQKLKYLCEKNEKVFFSSIRNGSS |
| A0A0B1TRS0 | 8-67 | None |
| A0A4Z2GEN9 | 1-63 | None |
| C3ZEP0 | 243-322 | None |
| A0A4Z2E7G4 | 27-80 | None |
| A0A7R9E9C6 | 676-742 | None |
| A0A060WYP1 | 1072-1135 | None |
| A0A2I0U2J7 | 316-376 | None |
| A0A553QBX2 | 20-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.