DPCstruct | MC3809
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 198 ± 26 aa |
| Standard deviation of domain lengths | 26.29 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A831YZR7 | 6-231 | ELEPGAASPEERFDSMKALRLAGLYPIVFVRPILPGITDREINEILKLAKEHGAVGALFGSLRLSPSILARIRNYVNQEELTRRIPR… |
| A0A1C3NY75 | 5-179 | NDSEEHLDAAYTLAKHADATVFTGLFYRDQIAECYKANGLPEPYEDTARRKIVPETLERRVLASFDATTPLFRKTSCAVAYAHGLPD… |
| A0A2G7AAE8 | 1-177 | None |
| A0A495W1A9 | 48-255 | None |
| A0A2N0GMS2 | 61-246 | None |
| A0A7C2VXV9 | 68-301 | None |
| A0A1F7KAI7 | 198-388 | None |
| A0A2D6KU55 | 234-406 | None |
| A0A0G0QZG4 | 188-449 | None |
| A0A4R0G6N9 | 331-513 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.