DPCstruct | MC38085
Metacluster Properties and Pfam Annotations
| Number of structural domains | 3364 |
|---|---|
| Mean domain length (aa) | 172 ± 33 aa |
| Standard deviation of domain lengths | 32.85 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 16.16 |
| Pfam Score | 92.50 |
| Assigned Pfam label(s) | CL0020- PF16963- CL0304- PF11559- PF11294 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8IJJ6 | 10-162 | LKIRSEIDEEIRRHKTERTVLFTDIVGSTNYFDRFGDTAGLLLIQRHDDFVASAVRQFQGVVIKTIGDSVMAEFPEPLLAVRAAVEI… |
| A0A7J8FMZ6 | 8-151 | YVRDFEADDTCLAHCWVVVRLDGRNFHRFSEKHNFAKPNDSRALHLMTKCAQTVMEELEDIVIAYGQSDEYSFVFKRKSNWFKRRAS… |
| A0A3M1BRV7 | 614-811 | None |
| A0A538QEA6 | 234-391 | None |
| A0A538PYS9 | 120-290 | None |
| A0A1G0ZIW0 | 671-881 | None |
| A0A2P7B837 | 1-153 | None |
| A0A522XAN8 | 606-780 | None |
| A0A100HM64 | 3-130 | None |
| A0A840RP02 | 245-429 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.